Protein Info for PfGW456L13_2119 in Pseudomonas fluorescens GW456-L13
Updated annotation (from data): L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48)
Rationale: Specifically important for: D-Galactose; L-Arabinose. Both of these sugars are catabolized via a 1-dehydrogenase followed by lactonase and dehydratase reactions. This is the only dehydrogenase is specifically important for either of these carbon sources in several Pseudomonas, except for an alpha-ketoglutarate semialdehyde dehydrogenase that is expected to be the last dedicated step in L-arabinose catabolism (i.e., Pf6N2E2_612). L-arabinose and D-galactose are chemically similar and some dehydrogenases are already known to act on both substrates.
Original annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_4142)Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
- biotin biosynthesis I (13/15 steps found)
- (5Z)-dodecenoate biosynthesis I (6/6 steps found)
- cis-vaccenate biosynthesis (5/5 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- (5Z)-dodecenoate biosynthesis II (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- stearate biosynthesis IV (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- D-galactose degradation II (1/2 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- petroselinate biosynthesis (2/6 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (20/205 steps found)
- superpathway of mycolate biosynthesis (21/239 steps found)
KEGG Metabolic Maps
- Ascorbate and aldarate metabolism
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Galactose metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.100
Use Curated BLAST to search for 1.1.1.100 or 1.1.1.46 or 1.1.1.48
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QJ38 at UniProt or InterPro
Protein Sequence (272 amino acids)
>PfGW456L13_2119 L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (Pseudomonas fluorescens GW456-L13) MAEPLSLPPVPEPPRGERLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEK VAAHWRDQGADVVAIKADVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLEMTEE DWRRCFAIDLDGAWYGCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGL TRALGIEYAPKGVRVNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEV AMTAVFLASDEAPFINASCITIDGGRSVMYHD