Protein Info for PfGW456L13_2111 in Pseudomonas fluorescens GW456-L13

Annotation: DNA polymerase III delta prime subunit (EC 2.7.7.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF13177: DNA_pol3_delta2" amino acids 10 to 159 (150 residues), 155.6 bits, see alignment E=1.1e-49 TIGR00678: DNA polymerase III, delta' subunit" amino acids 12 to 200 (189 residues), 208.5 bits, see alignment E=3.3e-66 PF09115: DNApol3-delta_C" amino acids 210 to 321 (112 residues), 37.2 bits, see alignment E=3.5e-13

Best Hits

Swiss-Prot: 75% identical to HOLB_PSEAE: DNA polymerase III subunit delta' (holB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02341, DNA polymerase III subunit delta' [EC: 2.7.7.7] (inferred from 94% identity to pfo:Pfl01_4151)

Predicted SEED Role

"DNA polymerase III delta prime subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNZ5 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PfGW456L13_2111 DNA polymerase III delta prime subunit (EC 2.7.7.7) (Pseudomonas fluorescens GW456-L13)
VAEAYPWQENLWQQLAGRTQHAHAYLLHGPAGIGKRALAERLMASLLCQRPNALQACGEC
KSCLLLKAGSHPDNYILEPEEADKAIKVDQVRDLVGFVVQTAQLGGRKVVLIEPAESMNI
NAANALLKSLEEPSGDTVLLLVSHQPSRLLPTIKSRCVQQACPLPGEAMSLKWLAQALPE
CSEDERVELLTLAAGSPLAAVNLQAQGVREQRAQVVEGVKKLLKQQQSPTQLAEEWKNIP
MLRLFDWFCDWSSLILRYQLTQDEAGLGLTDMRKVVQYLAQKSAQGKVLDIQDWILAQRQ
KVLSKANLNPALLLEALLVQWASLPAQR