Protein Info for PfGW456L13_2088 in Pseudomonas fluorescens GW456-L13

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 4 to 246 (243 residues), 313 bits, see alignment E=6e-98 PF02348: CTP_transf_3" amino acids 7 to 226 (220 residues), 214.9 bits, see alignment E=1.2e-67 PF12804: NTP_transf_3" amino acids 20 to 124 (105 residues), 46.1 bits, see alignment E=6.1e-16

Best Hits

Swiss-Prot: 92% identical to KDSB_PSEPF: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 92% identity to pfo:Pfl01_4173)

MetaCyc: 58% identical to 3-deoxy-manno-octulosonate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
3-deoxy-manno-octulosonate cytidylyltransferase. [EC: 2.7.7.38]

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLW0 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PfGW456L13_2088 3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38) (Pseudomonas fluorescens GW456-L13)
MTTAFTVVIPSRYASTRLPGKPLLLIAGKPMIQHVWEQASKSSAERVVVATDDARIVEAC
NGFGAEVVLTREDHNSGTDRLAEVAMKLGLAPDAIVVNVQGDEPLIPPNVIDQVAANLAA
HAEARMATLAEPIEDVDTLFNPNVVKVVSDLNGLALTFSRSTLPWARDAFAVNREQLPEG
VPYRRHIGIYAYRAGFLQDFVNWGPCWLENTECLEQLRALWHGVRIHVADALIAPPPGVD
TVEDLERVRRLLEA