Protein Info for PfGW456L13_2064 in Pseudomonas fluorescens GW456-L13

Annotation: Predicted ATPase with chaperone activity, associated with Flp pilus assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a4093)

Predicted SEED Role

"Predicted ATPase with chaperone activity, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

See A0A293PZ12 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PfGW456L13_2064 Predicted ATPase with chaperone activity, associated with Flp pilus assembly (Pseudomonas fluorescens GW456-L13)
MHVIVESDAYPSDRGAVQRLAPQPCTIRETGLTDSFLGELVCKHLFDAGVLDMSRLVERL
ALTGAVLEEVLAFLRKDGRVEVLGQVSQTGGQMLRYGLTERGRSAARDALSRSGYIGAAP
FPVSTYRSLIKLQTIHHGRINANDMRNALAGVVLTEEMLDQLGVAMNSGRAIMIYGPAGT
GKTYVSSRLIRLFAEAIWVPHAIVINESVIEIYDPQVHQRLDDNAQQNTLMLNEGIDRRL
LCCKRPIVITGGELSMEQLDVRYDPFTRQYQAALQLKASNGLFIIDDMGRQRMAPAELFN
RWIVPMEEKRDFLNLGGGRHCELPFDLILVFSTNLNPLELADEAFLRRIGYKLQFGYLKP
EQYEKIWRQESERLGISYDPLLVRYVLQRLYASEGMPLVPCHPRDLLNMALDRQRYIGGS
GPLSPKELEWAWHNYFVQLDFL