Protein Info for PfGW456L13_2046 in Pseudomonas fluorescens GW456-L13

Annotation: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 207 to 216 (10 residues), see Phobius details PF02558: ApbA" amino acids 20 to 124 (105 residues), 29.7 bits, see alignment E=1.1e-10 PF03807: F420_oxidored" amino acids 20 to 121 (102 residues), 38.3 bits, see alignment E=4.1e-13 PF01210: NAD_Gly3P_dh_N" amino acids 20 to 173 (154 residues), 172.7 bits, see alignment E=1.4e-54 PF07479: NAD_Gly3P_dh_C" amino acids 193 to 333 (141 residues), 170.6 bits, see alignment E=5.9e-54 PF20618: GPD_NAD_C_bact" amino acids 253 to 317 (65 residues), 67.4 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 96% identical to GPDA_PSEPF: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 96% identity to pfo:Pfl01_4208)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMQ1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>PfGW456L13_2046 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (Pseudomonas fluorescens GW456-L13)
MPTSPLVWINGLHMTEQRPIAVLGGGSFGTAVANLLAENGHQVLQWMRDPEQAEAIRVNR
ENPRYLKGIKILPGVTPVTDLQATLDACDLCFVALPSSALRSVLVPHAERLSGKMLVSLT
KGIEAHTFKLMSEILEEIAPQARIGVLSGPNLAREIAEHALTATVVASEDEELCQQVQAA
LHGRTFRVYASADRFGVELGGALKNVYAIIAGMAVALGMGENTKSMLITRALAEMTRFAV
NQGANPMTFLGLAGVGDLIVTCSSPKSRNYQVGFALGQGLSLDEAVTRLGEVAEGVNTLK
VLKAKAQEVGVYMPLVAGLHAILFEGRTLEQVIGLLMRGEPKTDVDFISTSGFN