Protein Info for PfGW456L13_2033 in Pseudomonas fluorescens GW456-L13

Annotation: 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) ## LSU rRNA m(5)U1939

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 23 to 75 (53 residues), 29.3 bits, 1.9e-10
• PF05958: tRNA_U5-meth_tr
  • amino acids 108 to 447 (340 residues), 98.7 bits, E=1.1e-31
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 271 to 442 (172 residues), 204.2 bits, E=1.6e-64
• PF05175: MTS
  • amino acids 299 to 369 (71 residues), 26.5 bits, E=1.4e-09
• PF13847: Methyltransf_31
  • amino acids 304 to 375 (72 residues), 32.6 bits, E=2e-11
• PF13649: Methyltransf_25
  • amino acids 308 to 363 (56 residues), 34.1 bits, 1.1e-11
• PF08241: Methyltransf_11
  • amino acids 309 to 371 (63 residues), 22.1 bits, E=5.7e-08

Best Hits

Swiss-Prot: 92% identical to RLMD_PSEPF: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 92% identity to pfo:Pfl01_4218)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A293PYZ4 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PfGW456L13_2033 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) ## LSU rRNA m(5)U1939 (Pseudomonas fluorescens GW456-L13)
MAKHERGLRFQPTGGSKAPQVPTGKKQRLTIERLANDGRGIAFFEGRTWFVIGALAGEEI
EARVLGAHGKVVEARTERVFKASELRRPAPCAHAGRCGGCSVQHLPHNEQLALKQRMLAE
QLSRVAGVEPDEWAAPLSGAEFAYRRRARVAVRWDMKAKKLEVGFRAAGSQDIVGIDDCP
VLVQPLQPIMARLPEMLRRLSKPQALGHVELFSGSTLAVLLRHMAPLSDADLTILKEFCA
FHEAQLWLHGDGEPQPVEADQSLGYRLEQWDLELAYRPGDFIQVNAAVNEAMVAQALDWL
KPTADERVLDLFCGLGNFALPLAKAAREVVAVEGVQVMVDRAAANAASNNLHNAKFFQAD
LSQPLTDAEWAAEGFCAVLLDPPRDGAFEVVRKLRSLGAERLVYVSCNPATLARDTVELI
KQGYRLKRAGILDMFPQTAHVEAMALFEAS