Protein Info for PfGW456L13_2031 in Pseudomonas fluorescens GW456-L13

Annotation: Two-component sensor histidine kinase PfeS, enterobactin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details PF16750: HK_sensor" amino acids 39 to 146 (108 residues), 115.6 bits, see alignment E=2.9e-37 PF00672: HAMP" amino acids 173 to 226 (54 residues), 36.8 bits, see alignment 8.1e-13 PF00512: HisKA" amino acids 232 to 289 (58 residues), 46 bits, see alignment 8.7e-16 PF02518: HATPase_c" amino acids 338 to 436 (99 residues), 64.8 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 50% identical to PFES_PSEAE: Sensor protein PfeS (pfeS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_4220)

Predicted SEED Role

"Two-component sensor histidine kinase PfeS, enterobactin" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNR5 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PfGW456L13_2031 Two-component sensor histidine kinase PfeS, enterobactin (Pseudomonas fluorescens GW456-L13)
LPGRHSLFWKLACLLVAFCLLMIWLSWSWGRYMEQRNQFLSDEARGTLSGYAAEAEQVWQ
QRQSAGIDDWLQGMHQREKGWVGVIGGDLQSLSNQSLTDKEVERLTFLRGLDWPIHKKGR
PWMRIPFPGDPSVGSLVIELPKRFVPGRYRVFWRVITNGVIPGLFTLLLCVGLYRLLVVP
LNSLREQANAWRADQLNVRLSSRTTNRSDELGELGRAFDHMSERLQSTVALQQQLLRDLS
HELRTPLSRLRVASESEQGLEPLRERIGREVDGMQRLVEDTLQLAWLDTERTRLPDEAIQ
IQALWEMLTENACYESGWPDTQLQCTVDSSCWVRGHLNTLAQALENILRNAIRHSPDGGV
VLLGGRRDGDFWHLWLEDQGGGVAEADLERIFLPFTRLDGSRPGDGGFGLGLSIARNAVQ
RQGGQLWAQNTGTGLRLNMRLLADVDSASADAIAVKPAPTLTVLEPRNL