Protein Info for PfGW456L13_2009 in Pseudomonas fluorescens GW456-L13

Annotation: 4'-phosphopantetheinyl transferase entD (EC 2.7.8.-); Holo-[acyl-carrier protein] synthase, alternative (EC 2.7.8.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF17837: 4PPT_N" amino acids 53 to 117 (65 residues), 80.6 bits, see alignment E=7.1e-27 PF01648: ACPS" amino acids 124 to 220 (97 residues), 53.8 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K02362, enterobactin synthetase component D [EC: 2.7.8.-] (inferred from 85% identity to pfo:Pfl01_4243)

Predicted SEED Role

"4'-phosphopantetheinyl transferase entD (EC 2.7.8.-); Holo-[acyl-carrier protein] synthase, alternative (EC 2.7.8.7)" (EC 2.7.8.-, EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QX75 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PfGW456L13_2009 4'-phosphopantetheinyl transferase entD (EC 2.7.8.-); Holo-[acyl-carrier protein] synthase, alternative (EC 2.7.8.7) (Pseudomonas fluorescens GW456-L13)
MNSTPALPVCCTPLDDHWPLPFALPDTVLLSTHFDSARLDSDDFQRSAVEAPASIQRSVA
KRQAEFLAGRVCARAALQRLEGLSFIPAIGEDRAPVWPAHITGSITHSTGRAAAIVANKS
HWRGLGMDLENLLNAERAERLAGEILNPPELQRMAAGDHDQRALLVTLTFSVKESLFKAL
YPIVQQRFYFEHAEVLEWRESGEVRLRLLTDLSSEWRNGTELDAQFGVKDGQLLSLVSIK
A