Protein Info for PfGW456L13_198 in Pseudomonas fluorescens GW456-L13

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 234 to 250 (17 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 43 to 366 (324 residues), 97 bits, see alignment E=5.8e-32

Best Hits

KEGG orthology group: None (inferred from 77% identity to pfo:Pfl01_0479)

Predicted SEED Role

"acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PWF1 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PfGW456L13_198 acyltransferase family protein (Pseudomonas fluorescens GW456-L13)
MTETNPLIAMAAYLLAIATAALLLRSVPKIPRELEHWGESRFAGIDGLRGYLAFGVFVHH
SIITWIFLKTGVIDFPPSNFYSQLGQGSVALFFMITGFLFWNRLLTHGRQHDWLAFAVSR
LFRLYPLYLPLMLTVFVCVFYLQDWELKDSGTQLIGQTLAWLIFDRPDVNQYHQTGMLIS
NVTWTLGYELFFYLALPLAAMVFIYRGGWMQTVLCLIGIYTLYQVVGWEHSLKKHFLASF
LGGIAAAYWIRRPQCVAWSLSPLAGIVALLALAIAFTAFNRAFNLGALLLLSLFFVIVAS
GNTLFGALRPRSIRWLGEISYSTYLLHGFVLWVLVQRLPPILHLDVRQAWVFLPLLAVCS
CLLIIISSLAYLYIEKPGINAGKKTLHWLRQNRKPRKELPEETAQQR