Protein Info for PfGW456L13_1931 in Pseudomonas fluorescens GW456-L13

Annotation: Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13527: Acetyltransf_9" amino acids 5 to 142 (138 residues), 34.8 bits, see alignment E=3e-12 PF00583: Acetyltransf_1" amino acids 33 to 140 (108 residues), 57 bits, see alignment E=4.8e-19 PF13508: Acetyltransf_7" amino acids 44 to 141 (98 residues), 42.5 bits, see alignment E=1.4e-14 PF13673: Acetyltransf_10" amino acids 46 to 162 (117 residues), 37 bits, see alignment E=6.3e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_4331)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKW6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PfGW456L13_1931 Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1) (Pseudomonas fluorescens GW456-L13)
MNTVIRNVTPVDLDRCFAIETLAYEGDEAATREKIATRIATWPEGFIVAEVDGVVAGFIN
SGAAFQVEMSDEAFKELIGHDPAGPHVVIMSVVVHPDYQGQGLAKRLMGEFIERMRGMGK
VTINLMCKERHIPLYAGFGFAYVKPSASDHGGMAWHEMVLEL