Protein Info for PfGW456L13_1922 in Pseudomonas fluorescens GW456-L13

Annotation: Uncharacterized glutathione S-transferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF02798: GST_N" amino acids 5 to 77 (73 residues), 52.5 bits, see alignment E=1e-17 PF13417: GST_N_3" amino acids 11 to 80 (70 residues), 41.4 bits, see alignment E=3.1e-14 PF13409: GST_N_2" amino acids 14 to 77 (64 residues), 48 bits, see alignment E=3.2e-16 PF00043: GST_C" amino acids 141 to 201 (61 residues), 23.6 bits, see alignment E=9.9e-09

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 70% identity to pba:PSEBR_a4028)

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMZ2 at UniProt or InterPro

Protein Sequence (212 amino acids)

>PfGW456L13_1922 Uncharacterized glutathione S-transferase-like protein (Pseudomonas fluorescens GW456-L13)
MEHALKILGKASSINVRKVLWTCEELGIVYEREDWGSGFASTHSPEFLRFNPNAQVPVII
DEAGVLWESNTICRYLAGKHHHHHSELLPIEPAARARVEQWMDWQATELNPSWRYPFMAL
VRKDPEFQDPHSLEIGIRSWNQKMGILEHQLATTKGYVAGPHFTLADVVIGLSVNRWLMT
PIDRPDYPTVDEYFQRLAQRPGFLKHGCNGLP