Protein Info for PfGW456L13_1908 in Pseudomonas fluorescens GW456-L13

Annotation: enoyl-CoA hydratase, R-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01575: MaoC_dehydratas" amino acids 17 to 115 (99 residues), 89.9 bits, see alignment E=9.7e-30 PF13452: MaoC_dehydrat_N" amino acids 17 to 131 (115 residues), 41.8 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfl:PFL_4601)

MetaCyc: 85% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]

Predicted SEED Role

"enoyl-CoA hydratase, R-specific" in subsystem n-Phenylalkanoic acid degradation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.119

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4THA3 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PfGW456L13_1908 enoyl-CoA hydratase, R-specific (Pseudomonas fluorescens GW456-L13)
MTQVTNTPYEALEVGQTASFSKTVEERDIQLFAAMSGDHNPVHLDAEYAASTMFKERIAH
GMFSGALISAAVACELPGPGTIYIGQQMSFQKPVKIGDTLTVRLEILEKLPKFRVRIATR
VFNQRDELVVDGEAEILAPRKQQSVTLTELPAISIG