Protein Info for PfGW456L13_1894 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): ABC transporter for D-Galactose and D-Glucose, periplasmic substrate-binding component
Rationale: Specific phenotype on D-Fructose; L-Aspartic Acid; D-Galactose; L-Lysine. The nitrogen source phenotypes for aspartate and lysine are with glucose as the carbon source. May also transport fructose.
Original annotation: Glucose ABC transport system, periplasmic sugar-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 68 to 316 (249 residues), 80.1 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 46% identical to SP39_RHIME: Probable sugar-binding periplasmic protein (R03301) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 92% identity to pfl:PFL_4617)

Predicted SEED Role

"Glucose ABC transport system, periplasmic sugar-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QII5 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PfGW456L13_1894 ABC transporter for D-Galactose and D-Glucose, periplasmic substrate-binding component (Pseudomonas fluorescens GW456-L13)
MNAISRLATVISLASLSALPLSVLAAESKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFT
WKDGAVAGGGGSTAMTVLKSRAVAGNPPGVAQIKGPDIQEWGSTGLLSTDALKDVSKAEN
WDGLLSKKVSDTVKYEGDYVAVPVNIHRVNWLWINPEVFKKAGIEKAPTTLEEFYAAGDK
LKAAGFIALAHGGQPWQDSTVFEDVVLSVMGADGYKKALVDLDQKTLSGPEMTKSFAELK
KITGYMDPNRAGRDWNIAAADVISGKAGMQMMGDWAKSEWTAAKKIAGKDYQCVAFPGTE
KAFTYNIDSMAVFKLKADRKGDIAAQQDLAKVALGTDFQKVFSMNKGSIPVRNDMLNEMD
KLGFDECAQKSAKDFIADDKTGGLQPSMAHNMATSLAVQGAIFDVVTNFMNDKDADPAKA
SAQLASAVKAAQ