Protein Info for PfGW456L13_1883 in Pseudomonas fluorescens GW456-L13

Annotation: Heme oxygenase HemO, associated with heme uptake

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01126: Heme_oxygenase" amino acids 14 to 192 (179 residues), 68.9 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K07215, heme oxygenase (inferred from 85% identity to pfs:PFLU4969)

Predicted SEED Role

"Heme oxygenase HemO, associated with heme uptake" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLC7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>PfGW456L13_1883 Heme oxygenase HemO, associated with heme uptake (Pseudomonas fluorescens GW456-L13)
MTTQATEQRPNLRSQRLNQITHEPHSKLDALVKAHAPFETPANFARFVVAQYLFQSELVS
LYNDAELTAIVPDLPARCRADAARADLADLDTDVPAPAAGALKNPTKAEALGWIFVSEGS
KLGAAFLIKRAVGLGLSETFGARHLGEPAGGRAEGWKSFVKTLDGLAFSAQEEAEVEKGA
IDAFNRFTVLLERAYASAPEVA