Protein Info for PfGW456L13_1869 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): glycine cleavage system H protein (EC 1.4.1.27)
Rationale: Specific phenotype: utilization of L-Threonine (threonine is broken down via glycine)
Original annotation: Glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR00527: glycine cleavage system H protein" amino acids 3 to 122 (120 residues), 140.2 bits, see alignment E=2e-45 PF01597: GCV_H" amino acids 4 to 122 (119 residues), 132.7 bits, see alignment E=3.3e-43

Best Hits

Swiss-Prot: 83% identical to GCSH1_PSEPK: Glycine cleavage system H protein 1 (gcvH1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 91% identity to pfs:PFLU4896)

MetaCyc: 52% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM85 at UniProt or InterPro

Protein Sequence (127 amino acids)

>PfGW456L13_1869 glycine cleavage system H protein (EC 1.4.1.27) (Pseudomonas fluorescens GW456-L13)
MSELRFTEDHEWLRTEADGSVTVGITAFAQNALGDVVFVQLPELQSYDKGAEAATVESVK
AASGVYMPLDGEVLEVNPALDSSPELVNEDPLGEGWFFRFKPSDAAAVGQLLDQDAYDRL
IKAQAEA