Protein Info for PfGW456L13_1866 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): Aminomethyltransferase (EC 2.1.2.10)
Rationale: Specifically important for utilizing Glycine. Automated validation from mutant phenotype: the predicted function (2.1.2.10) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR00528: glycine cleavage system T protein" amino acids 7 to 368 (362 residues), 353.4 bits, see alignment E=6.5e-110 PF01571: GCV_T" amino acids 11 to 258 (248 residues), 296.7 bits, see alignment E=1.3e-92 PF08669: GCV_T_C" amino acids 289 to 367 (79 residues), 65.2 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 47% identical to GCST_DICDI: Aminomethyltransferase, mitochondrial (gcvT) from Dictyostelium discoideum

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 95% identity to pfo:Pfl01_4394)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNB8 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PfGW456L13_1866 Aminomethyltransferase (EC 2.1.2.10) (Pseudomonas fluorescens GW456-L13)
MSTEQLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQI
RLTGANAAKALETLVPVDIIDLPVGMQRYAMFTNATGGILDDLMVANLGNDELFLVVNAA
CKDQDLAHLRKHIGDQCTIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKL
LGVDCFVSRSGYTGEDGFEISVPATNAEALARALLAEAEVAAIGLGARDSLRLEAGLCLY
GHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQAGVSRKRVGLLPQERT
PVREGAEIVNEAGDIIGSVCSGGFGPTLGGPLAMGYVDSAYIALDTPVWAIVRGKKVPLL
VSKMPFVPQRYYRG