Protein Info for PfGW456L13_1863 in Pseudomonas fluorescens GW456-L13

Annotation: Quinolinate synthetase (EC 2.5.1.72)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 30 to 341 (312 residues), 361.5 bits, see alignment E=1.8e-112 PF02445: NadA" amino acids 34 to 339 (306 residues), 349.1 bits, see alignment E=9.7e-109

Best Hits

Swiss-Prot: 98% identical to NADA_PSEPF: Quinolinate synthase A (nadA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 98% identity to pba:PSEBR_a4425)

MetaCyc: 68% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QL99 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PfGW456L13_1863 Quinolinate synthetase (EC 2.5.1.72) (Pseudomonas fluorescens GW456-L13)
MTQISERLLVQAHLDAKQPKPLTADEEAYYRAAIAAELKAQDAVLVAHFYCDPVIQALAE
ETGGCVSDSLEMARFGNAHPAKTVVVAGVKFMGETAKILNPEKRVLMPTLEATCSLDLGC
PVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGETIIWGPDK
HLGTYIQRQTGADMLLWDGACIVHEEFKSKQLEDMKALYPDAAILVHPESPTSVIELADA
VGSTSQLIAAAQSLPNKTLIVATDRGIFYKMQQLCPDKVFIEAPTAGNGAACRSCAHCPW
MAMNTLERTLKALKEGANEIFVDPALIPQAIRPLKRMLDFTQAARMKLAGNA