Protein Info for PfGW456L13_1829 in Pseudomonas fluorescens GW456-L13

Annotation: glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 15 to 176 (162 residues), 67.3 bits, E=4.4e-22
• PF13579: Glyco_trans_4_4
  • amino acids 46 to 166 (121 residues), 51.4 bits, E=3.9e-17
• PF00534: Glycos_transf_1
  • amino acids 188 to 324 (137 residues), 78.1 bits, E=1.5e-25
• PF13692: Glyco_trans_1_4
  • amino acids 199 to 324 (126 residues), 80.1 bits, E=4.8e-26
• PF13524: Glyco_trans_1_2
  • amino acids 270 to 353 (84 residues), 28.2 bits, E=4.5e-10

Best Hits

KEGG orthology group: K14335, alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 86% identity to pfo:Pfl01_4432)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See A0A293QL60 at UniProt or InterPro

Protein Sequence (370 amino acids)

>PfGW456L13_1829 glycosyl transferase, group 1 family protein (Pseudomonas fluorescens GW456-L13)
VHIADITMFYAPASGGVRTYLDAKHRRLGIKPGIRHSLLIPGSSFGEQDGIFTVPAPALP
FGKGYRFPLRLAPWRNVLQDLQPDLIEVGDPYLTAWAALDARRQLDVPIIGFYHSDLPLL
VSNRMGNWVTNNVEAYVSKLYGNFDRVLAPSRVMADKLTGLGVRNVFVQPLGVDLQTFNP
DARDPGLRAELGLDENTHLLIFAGRGSKEKNLPVLLDCMKRLGRRYHLLLVGSSMPTAVP
SNVTVIDEFCPAAQVARLMASADALLHAGDQETFGLVILEAMASGIPVVAVAAGAFEEIV
TEDCGLLCAPNNPAAMATAVRELFGSGSVALGQQARLHVERHYAWDTVVTSLLRHYHAVL
GSQWPLTANG