Protein Info for PfGW456L13_1805 in Pseudomonas fluorescens GW456-L13

Annotation: Dicarboxylate MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 40 to 51 (12 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 32 to 244 (213 residues), 109 bits, see alignment E=2.8e-35 amino acids 223 to 431 (209 residues), 39.6 bits, see alignment E=3.2e-14 PF07690: MFS_1" amino acids 37 to 380 (344 residues), 107.8 bits, see alignment E=6e-35

Best Hits

Swiss-Prot: 57% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 97% identity to pfs:PFLU4955)

MetaCyc: 57% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Dicarboxylate MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNC9 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PfGW456L13_1805 Dicarboxylate MFS transporter (Pseudomonas fluorescens GW456-L13)
MDNSNSLPLGSAAAPAKERTTSSRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKTFFPKG
DTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADKVGRKKALMASVYLMCFGSLLIALSPGY
EVIGIGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFYSSFQYVTLISGQLIA
LAVLIVLQNFLTTEELYAWGWRIPFAIGALCAVVALYLRRGMEETESFTKKEKAKESAMR
TLMRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PIIGGLSDKIGRRPILIAFGILGTLFTVPILTTLHTITTWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LLVYITMKDTRKHSRIVTD