Protein Info for PfGW456L13_1783 in Pseudomonas fluorescens GW456-L13

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 151 (151 residues), 31.7 bits, see alignment E=3.1e-11 PF05368: NmrA" amino acids 2 to 109 (108 residues), 40.1 bits, see alignment E=1.2e-13 PF01370: Epimerase" amino acids 3 to 227 (225 residues), 117.7 bits, see alignment E=2.1e-37 PF01073: 3Beta_HSD" amino acids 4 to 250 (247 residues), 106.5 bits, see alignment E=4.6e-34 PF16363: GDP_Man_Dehyd" amino acids 4 to 244 (241 residues), 42.4 bits, see alignment E=2.2e-14 PF13460: NAD_binding_10" amino acids 7 to 148 (142 residues), 57.9 bits, see alignment E=4.5e-19 PF07993: NAD_binding_4" amino acids 44 to 170 (127 residues), 49.1 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_4482)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM00 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PfGW456L13_1783 Nucleoside-diphosphate-sugar epimerases (Pseudomonas fluorescens GW456-L13)
MKILVTGASGFIGGRFARFALEQGLDVRVNGRRAESVEHLVRRGAEFIQGDLSDPELARE
LCSDVEAVVHCAGAVGLWGRYQDFHQGNVQVTENVVEACLKQRVRRLVHLSSPSIYFDGR
DHLGLTEDQVPKRFKHPFAATKYLAEQKVFGAQEFGLETLALRPRFVTGAGDMSIFPRLL
NMQRKGRLAIIGNGLNKVDFTSVQNLNEALLSSLLASGSALGKAYNISNGTPIPLWDVVN
YVMRNMEVPQVTRYRSYGLAYSVAALNEGVCKLWPGRPEPTLSRLGMQVMNKNFTLDISR
ARHYLDYDPKVSLWTALDEFCGWWKAQAVR