Protein Info for PfGW456L13_1767 in Pseudomonas fluorescens GW456-L13

Annotation: DNA-binding response regulator ColR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 3 to 114 (112 residues), 106.7 bits, see alignment E=7.7e-35 PF00486: Trans_reg_C" amino acids 149 to 220 (72 residues), 62.9 bits, see alignment E=2.5e-21

Best Hits

Swiss-Prot: 42% identical to QSEB_ECO57: Transcriptional regulatory protein QseB (qseB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to pfl:PFL_4836)

Predicted SEED Role

"DNA-binding response regulator ColR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QI45 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PfGW456L13_1767 DNA-binding response regulator ColR (Pseudomonas fluorescens GW456-L13)
MRILLVEDNRDILANLADYLGLKGYTVDCAQDGLSGLHLAATEHYDLIVLDIMLPGIDGY
TLCKRLREDARRETPVIMLTARDQLDDRLQGFKSGADDYLIKPFALSELAARIEAVMRRT
QGGGRRTLQVGDLSYDLDTLEVTREGRLLKLNPVGLKLLAVLMQKSPHVLRREILEEALW
GDDCPDSDSLRSHVHQLRQVIDKPFAKPLLQTVHGVGYRLAEGRDGV