Protein Info for PfGW456L13_1766 in Pseudomonas fluorescens GW456-L13

Annotation: PAP2 superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details PF01569: PAP2" amino acids 101 to 231 (131 residues), 68.1 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: None (inferred from 82% identity to pfo:Pfl01_4500)

Predicted SEED Role

"PAP2 superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QL01 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PfGW456L13_1766 PAP2 superfamily protein (Pseudomonas fluorescens GW456-L13)
MVSTLARPAPRPLNFWVCLGVPAVAAIILVLLELTSLDMDLAKLFYDPVTGEFIGRHSYF
LEDILHDRAKQVVIAFSVFAILAFIASFFMARLKPLKRELGCLVLSLGLATSFVTPIKAV
TAVQCPWSLEQFGGHETYSELLSPRPHTDKPGRCWPGGHAATGFTLFALFFVLRDRRPRM
ARAALVFAFSLGSVFSIGRMMQGAHFFSHNVWTAVFCWLICLGSYYYVLYRPALRADRVA
SAEPVSA