Protein Info for PfGW456L13_1751 in Pseudomonas fluorescens GW456-L13

Annotation: DNA-binding response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF00072: Response_reg" amino acids 2 to 95 (94 residues), 70.8 bits, see alignment E=1.1e-23 PF00196: GerE" amino acids 127 to 182 (56 residues), 71.3 bits, see alignment E=4e-24

Best Hits

Swiss-Prot: 60% identical to BVGA_BORPE: Virulence factors putative positive transcription regulator BvgA (bvgA) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K07690, two-component system, NarL family, response regulator EvgA (inferred from 93% identity to psp:PSPPH_1374)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4T1K8 at UniProt or InterPro

Protein Sequence (188 amino acids)

>PfGW456L13_1751 DNA-binding response regulator, LuxR family (Pseudomonas fluorescens GW456-L13)
MERHGYEVIAETDNGVDALQLARELMPDIVILDIGIPKLDGLEVIARLSSTSMPMKVLIL
TSQAPGHFSMRCMQSGAAGYVCKQQDLTELLSAIKAVLSGYSYFPNQALHTVRCSLGNAS
EADMVDRLSGREMMVLQQLARGKTNKEIADGMFLSNKTVSTYKTRLLLKLNARSLVDLIE
LAQRNGLV