Protein Info for PfGW456L13_1714 in Pseudomonas fluorescens GW456-L13

Annotation: Glutamate synthase [NADPH] small chain (EC 1.4.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 27 to 251 (225 residues), 139.4 bits, see alignment E=6.6e-45

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_1017)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKU6 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PfGW456L13_1714 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) (Pseudomonas fluorescens GW456-L13)
LYAAATIYQGTRLASGAKVNKRLLVMLGVLAVLAHSVSLLTHLLTPTGLALDFFSAASLI
AVAVIALTLLACSRIPVENLLVLLLPLGALTVLLAHFAPAGTVQIINEEPGILAHILLSI
LAYGMFTIAVFQSLLLLIQDHQLKHKHPSGLIKNFPPLQTMESLLFGFLWAGWTLLSLSL
ISGWLFVENLFAQHLVHKTLLACLAWVVFSVLLWGRNRLGWRGHKAIRWTLAGFCLLMLA
YFGSKLVREYILHI