Protein Info for PfGW456L13_1713 in Pseudomonas fluorescens GW456-L13

Annotation: Magnesium and cobalt efflux protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 78 (29 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 129 to 144 (16 residues), see Phobius details PF01595: CNNM" amino acids 15 to 163 (149 residues), 53.5 bits, see alignment E=3.6e-18 PF00571: CBS" amino acids 192 to 247 (56 residues), 19 bits, see alignment 2.2e-07 amino acids 261 to 311 (51 residues), 31.6 bits, see alignment 2.6e-11 PF03471: CorC_HlyC" amino acids 328 to 400 (73 residues), 64.2 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfo:Pfl01_1016)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QME0 at UniProt or InterPro

Protein Sequence (410 amino acids)

>PfGW456L13_1713 Magnesium and cobalt efflux protein CorC (Pseudomonas fluorescens GW456-L13)
MDDLPIGPMLAVVTLLVLWSGLFTAIEAAHQHLLAQRTATRSSDKPVAKLSFPLASLIFC
NTLCRALVVVISTLLALFTWAENGPWVACLGAGAMLLVFSDYLPRALATRYPDAILAQGN
NLLRLPLKIIYPAAWLLNSISQLLTRPFARKAKVVQQSEDETLTERHAPSETASRPHPLP
GIHALDNITVNDILVPRSDVDGINLDDSIEEIIEQLRHNKRTRLPVFHSDINQVEAVLNT
RHILHLLPDASLTREALLAASHEPYFVPESTPLQLQLLNFHKQQRRLGMVVDEYGEVLGI
VTLEDILEEIVGEFESQQSLDNPHIHPQADGRLVIDGAASIRELNKSLGWHLPSDGPKTL
NGLVTEALETIPESAVCLKIGRYRLEILETEENRVTRVLIWQTSPMPVVI