Protein Info for PfGW456L13_1686 in Pseudomonas fluorescens GW456-L13
Annotation: UPF0246 protein YaaA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to Y961_PSEPF: UPF0246 protein Pfl01_0961 (Pfl01_0961) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: K09861, hypothetical protein (inferred from 95% identity to pfl:PFL_1025)Predicted SEED Role
"UPF0246 protein YaaA" in subsystem YaaA
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QHX7 at UniProt or InterPro
Protein Sequence (259 amino acids)
>PfGW456L13_1686 UPF0246 protein YaaA (Pseudomonas fluorescens GW456-L13) MLMVISPAKTLDYETPPATQRFTQPQYLDHSQELILQLRELTPAQISELMHVSDKIGGLN AARFGSWTPAFTPENAKQALLAFKGDVYTGMNAQTLSEADFDYAQKHLRMLSGLYGLLRP LDLMQPYRLEMGTKLANARGKDLYAFWGTRISEWLNEALVDQGDDVLLNLASNEYFSAVK RNALNARIINTEFKDLKNGQYKIISFYAKKARGLMSRFVIEERINDPATLKQFDVQGYRY SAEQSKPDNLVFLRDHAPE