Protein Info for PfGW456L13_1681 in Pseudomonas fluorescens GW456-L13

Annotation: outer membrane protein AlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13372: Alginate_exp" amino acids 32 to 488 (457 residues), 326.1 bits, see alignment E=1.5e-101

Best Hits

Swiss-Prot: 72% identical to ALGE_PSEPK: Alginate production protein AlgE (algE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_0956)

Predicted SEED Role

"outer membrane protein AlgE" in subsystem Alginate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK55 at UniProt or InterPro

Protein Sequence (494 amino acids)

>PfGW456L13_1681 outer membrane protein AlgE (Pseudomonas fluorescens GW456-L13)
MKLNPFMKAGIGLTFALIWSCPTLAAMTEETKNFGLDVKITGQSEDDRDLGTADGGDVNG
VGLDLRPWVYGESGAWSAYAMGQAVTSTDIIETDTLQQSDGAENTDNGDRETKKNYLAMR
EFWVGYSGFTPYPGEILKFGRQRLRNDDGQWRDTNIEALNWTFDTTLLRANVGIAERFSE
YRTDLKELAPEDKDRLHAYADAAYQWTPGNWVGIRGHHTHDDGKLDYAQPGVPSDSLDKK
QNGDISWLGLTADSDAYNWRNTNTVNYWGSITGMSGDRDTVNPLNADGTAPAQAKRSGDV
DGWATDLGVRLRLDPQWQVGAAYARASEDYEQNGLESNRSNYTGTRSRVHRFGEAFRGEM
NNMQSATLFGSWMLNDEYDASLIYHKFWRVDGNKPVGSNGIDAVQNNTDDVTGAILSSTS
LPLNDGEKDLGQEMDLVVTKYFKQGLLPASMSQAIDEPSALVRLRGGVFKPGDAYGKEVD
SYMHRAFIDVIWRF