Protein Info for PfGW456L13_1662 in Pseudomonas fluorescens GW456-L13

Annotation: Heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 5 to 453 (449 residues), 431.9 bits, see alignment E=1.6e-133 PF00512: HisKA" amino acids 238 to 302 (65 residues), 53.1 bits, see alignment E=4.1e-18 PF02518: HATPase_c" amino acids 348 to 453 (106 residues), 82.8 bits, see alignment E=3.7e-27 PF14501: HATPase_c_5" amino acids 350 to 452 (103 residues), 27.5 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 89% identity to pfo:Pfl01_4664)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM89 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PfGW456L13_1662 Heavy metal sensor histidine kinase (Pseudomonas fluorescens GW456-L13)
VSSNSIALRLSAMFTLVALLVFLLIGWALYQQVDKGLGLLPEAELDARYSVLESTVGRYG
TPEHWVKINNKLNLLSEEDKRISFWIISGDPHYEYGNLTSQIRAFAQGPLGTRDMHLPEH
PYPLKVLVSEFPAKDQRPALRFMIAIDTETFFHTQHHLLVALISLAIAGVLLASALGYWV
ARIGLKPLIKLSQEAQRLAPPLRSGRLRLSPLPPELDQFVSSFNSTLERVEQAYSRLESF
NADVAHELRSPLTNLIGQTQVALTRGRSAEHYFEVLQSNLEELERLRSIINDMLFLASAD
QGSKATKLTSTSLADEVATTLEYLDFILEDAQVQVEVSGDAQVCIEIAHLRRALINLLSN
AVQHTAPGQVIQVRIEAQEHQVSIGVANPGSPIANEHLPRLFERFYRVDASRSNSGHNHG
LGLAIVKAIALMHGGDVFVRSDHGMNTFGIHLPV