Protein Info for PfGW456L13_1659 in Pseudomonas fluorescens GW456-L13

Annotation: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  • amino acids 2 to 298 (297 residues), 396.3 bits, E=4.5e-123
• PF03331: LpxC
  • amino acids 4 to 275 (272 residues), 375.4 bits, E=9e-117

Best Hits

Swiss-Prot: 99% identical to LPXC_PSEFS: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 98% identity to pba:PSEBR_a4615)

MetaCyc: 56% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Escherichia coli K-12 substr. MG1655)
UDPACYLGLCNACDEACETYL-RXN [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

See A0A0C1ZRG9 at UniProt or InterPro

Protein Sequence (303 amino acids)

>PfGW456L13_1659 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108) (Pseudomonas fluorescens GW456-L13)
MIKQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFCRADLDPVVQIPARAENVGET
TMSTTLINGDVKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLE
EQDAAKKFIRILREVTVEDGDKRATFVPFEGFKVSFEIDFDHPVFRDRTQSASVDFSSTS
FVKEVSRARTFGFMSDIEYLRKHNLALGGSVENAIVVDADGVLNEDGLRYEDEFVKHKIL
DAIGDLYLLGNSLIGEFKGFKSGHALNNQLLRKLIEQTDAWEVVTFEDASTAPISYMRPV
AAV