Protein Info for PfGW456L13_1581 in Pseudomonas fluorescens GW456-L13

Annotation: Glutamyl-tRNA reductase (EC 1.2.1.70)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01035: glutamyl-tRNA reductase" amino acids 1 to 393 (393 residues), 427.4 bits, see alignment E=2.9e-132 PF05201: GlutR_N" amino acids 1 to 134 (134 residues), 161.5 bits, see alignment E=1.9e-51 PF01488: Shikimate_DH" amino acids 150 to 284 (135 residues), 160.8 bits, see alignment E=3.1e-51 PF00745: GlutR_dimer" amino acids 299 to 395 (97 residues), 79.1 bits, see alignment E=4.2e-26

Best Hits

Swiss-Prot: 95% identical to HEM1_PSEFS: Glutamyl-tRNA reductase (hemA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 95% identity to pba:PSEBR_a4759)

MetaCyc: 50% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QHK5 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PfGW456L13_1581 Glutamyl-tRNA reductase (EC 1.2.1.70) (Pseudomonas fluorescens GW456-L13)
VAFTPEQLVEALQQLCRLTDSREAAILSTCNRSELYIEQDHLSADVVLRWLAEYHHLSYD
ELRESAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTIGPLLGRLF
QATFNAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLH
DLGVKRIVVANRTLERASILAEQFGAHAVLLSDIPAELVRSDIVISSTASQLPILGKGAV
ESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAE
EMVSIGAEDFMIRLRELAAVDVLKAYRQQSERLRDEELQKAQRMLANGTSAEEVLVQLAR
GLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALGEGSSDSFSDKKPQ