Protein Info for PfGW456L13_1568 in Pseudomonas fluorescens GW456-L13

Annotation: Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 83 to 111 (29 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 295 (201 residues), 36.5 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 92% identity to pfl:PFL_5175)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QHI6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PfGW456L13_1568 Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1) (Pseudomonas fluorescens GW456-L13)
MHALPIANTLERRRAFQSFLGVSPALIAIGLFLIVPILIVIGYSLMEANPYGGVNKVFSS
DAYTSLLFERQLDDSLAFADSYLIIALRSIGIAGLTTLITLLIGFPVAVWLAMQPAHRRG
LLIFLITVPFWANLLIRTYAWILLLRNTGVINNSLMGLGVIDQPLQLLYTDGAVLLGVVY
TYAPFVVLPIYATLEKMDIRLLEAAQDLYAGRVRTLRKVVLPIAKPGILAGAILTFVPCL
GAMIAPELLGGGTRMMLGNLIFRQFSDARNWPFGAALSLVLMAAVMLVLTVYALRAERQR
IAKGGA