Protein Info for PfGW456L13_156 in Pseudomonas fluorescens GW456-L13

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 TIGR00585: DNA mismatch repair protein MutL" amino acids 10 to 318 (309 residues), 336.6 bits, see alignment E=9.8e-105 PF02518: HATPase_c" amino acids 29 to 85 (57 residues), 29.7 bits, see alignment 1.5e-10 PF13589: HATPase_c_3" amino acids 32 to 133 (102 residues), 48.1 bits, see alignment E=2.5e-16 PF01119: DNA_mis_repair" amino acids 221 to 337 (117 residues), 137.9 bits, see alignment E=2.5e-44 PF08676: MutL_C" amino acids 450 to 592 (143 residues), 165.1 bits, see alignment E=1.7e-52

Best Hits

Swiss-Prot: 91% identical to MUTL_PSEFS: DNA mismatch repair protein MutL (mutL) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 95% identity to pfo:Pfl01_0521)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PWE4 at UniProt or InterPro

Protein Sequence (636 amino acids)

>PfGW456L13_156 DNA mismatch repair protein MutL (Pseudomonas fluorescens GW456-L13)
MNQVVNNSARIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAKRIDVDVEQGGVK
LLRVRDDGSGISADDLPLALARHATSKIRNLEDLEQVMSLGFRGEALASISSVARLTLTS
RTRDADQAWQVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKTEKTEFDHLQ
EVIRRLALARFDVAFHLRHNGKTILSLHEAHDDAARARRVAAICGPGFLEQALPIEIERN
GLHLWGWVGLPTFNRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFFE
VDPTGVDVNVHPTKHEVRFREGRMVHDFLYGTLHRALGDVRPDDQLAAPVATAIVRPTGL
EAGEFGPQGEMRLAANALLEQPQAQPSFNAPAGSGAGAGYQYQYTPRPQSGAPVAEAQAA
YREFFAPLPEANAVALPAGQDDIPPLGYALAQLKGIYILSENAQGLVLVDMHAAHERIMY
ERLKVAMASEGLSGQPLLVPESLAVSQREADCAEEHVAWFQRLGFELQRLGPETLAIRQI
PALLKQAEANRLVADVLADLMEFGTSDRIQAHLNELLGTMACHGAVRANRRLALPEMNGL
LRDMENTERSGQCNHGRPTWTQLGLDDLDKLFLRGR