Protein Info for PfGW456L13_1542 in Pseudomonas fluorescens GW456-L13

Annotation: Putative sulfite oxidase subunit YedY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00174: Oxidored_molyb" amino acids 114 to 271 (158 residues), 116 bits, see alignment E=6.9e-38

Best Hits

Swiss-Prot: 84% identical to MSRP_PSESM: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K07147, (no description) (inferred from 90% identity to pfo:Pfl01_4784)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJT1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PfGW456L13_1542 Putative sulfite oxidase subunit YedY (Pseudomonas fluorescens GW456-L13)
MLIKVPRASDCHESDVTPESLYLSRRKVLGATVAGFALGSLPQWASAGDAVRYPDVEPGK
APSWFSEKLPATQWGAISVKDEAITPFKDATHYNNFYEFGTDKGDPAANAGTLKTEPWSV
VVDGEVGKPGRYALEDLMKPYRLEERIYRLRCVEAWSMVIPWIGFPLSALLKEVEPTSKA
RFIRFETLQDPKSMPGQRSGFALIDWPYVEGLRLDEAMNPLAILAVGMYGRELPNQNGAP
LRLVVPWKYGFKSIKSIVRISLVSEQPKTTWQSIAADEYGFYANVNPTVDHPRWTQARER
RLPSGLFKPNVRDTQMFNGYSEEVSSLYTGLDLRKNY