Protein Info for PfGW456L13_1527 in Pseudomonas fluorescens GW456-L13

Annotation: glutamyl-Q-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 21 to 36 (16 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 9 to 274 (266 residues), 370 bits, see alignment E=3.6e-115 PF00749: tRNA-synt_1c" amino acids 12 to 234 (223 residues), 150.6 bits, see alignment E=2.6e-48

Best Hits

Swiss-Prot: 86% identical to GLUQ_PSEF5: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 90% identity to pfo:Pfl01_4805)

MetaCyc: 53% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMG4 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PfGW456L13_1527 glutamyl-Q-tRNA synthetase (Pseudomonas fluorescens GW456-L13)
MTATTSPTYIGRFAPTPSGHLHFGSLVAALASYLDARSVGGRWLMRMEDLDPPREVPGAQ
AAILKALESYGFEWDGGLVRQSERHDAYAEVIDRLFNQGLAYACTCSRKQLEPYHGIYPG
LCRNAGHGTDDAAIRLRVPELEYHFIDRVQGQYRQHLGREVGDFVIRRRDGLYAYQLAVV
LDDAWQGITDIVRGADLLDSTPRQLYLQELLGLPQPRYLHIPLITQPDGNKLGKSYRSPP
LTEDQATPLLLRALRALGQNPGTELTYATPREVLNWGIAHWDASLIPRTLSLPEAQLL