Protein Info for PfGW456L13_145 in Pseudomonas fluorescens GW456-L13

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13531: SBP_bac_11" amino acids 41 to 287 (247 residues), 76.1 bits, see alignment E=7.1e-25 PF01547: SBP_bac_1" amino acids 45 to 282 (238 residues), 73.8 bits, see alignment E=5.3e-24 PF13416: SBP_bac_8" amino acids 46 to 300 (255 residues), 78.1 bits, see alignment E=2.1e-25 PF13343: SBP_bac_6" amino acids 81 to 297 (217 residues), 85.1 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 92% identity to pfl:PFL_0574)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PWE2 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PfGW456L13_145 Ferric iron ABC transporter, iron-binding protein (Pseudomonas fluorescens GW456-L13)
MMFRNTLRRGLITTLLGLALATPLTQAADPVALTLYNGQHKEVGDAVAKAFEAKTGIHVN
VRKGSSNQLASQIVEEGDRSPADVIYTEESPPLNKLGEQGLLAKTEDATLAVLPKEYVAG
NGTWIGVTARVRVVAFNPKLIDEKDLPTSVMEFSDPKWQGKVGFVPTSGAFQEQAVAIIK
VHGMDAAEEWLTGLRAFGKTYSNNMVALKAVENGEVATVLVNNYYWFALQREKGQLDSKL
HYFSGGDVGGLITVSSAAVLKSSKHPKEAQQLLAYMASEEGQRVITQTTAEYPLHKGMES
DRGLKPFSELQAPKVTPADLGNAEEALDLERDVGLN