Protein Info for PfGW456L13_143 in Pseudomonas fluorescens GW456-L13

Annotation: 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 4 to 244 (241 residues), 267.5 bits, E=5e-84
• PF08032: SpoU_sub_bind
  • amino acids 7 to 80 (74 residues), 76.4 bits, E=1.8e-25
• PF00588: SpoU_methylase
  • amino acids 98 to 238 (141 residues), 142 bits, E=1.4e-45

Best Hits

Swiss-Prot: 92% identical to RLMB_PSESM: 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (rlmB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 96% identity to pfo:Pfl01_0533)

MetaCyc: 58% identical to 23S rRNA 2'-O-ribose G2251 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11588 [EC: 2.1.1.185]

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.185

Sequence Analysis Tools

See A0A293QIL8 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PfGW456L13_143 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) (Pseudomonas fluorescens GW456-L13)
MSQLEKIYGVHAVEALLRHHPKRVKQIWLAEGRNDPRVQTLIELANENRVQVGQAERREM
DAWVEGVHQGVVADVSPSQVWGEAMLDELLDRTDGAPLLLVLDGVTDPHNLGACLRSADA
AGALAVIVPKDKSATLTPVVRKIACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEA
EVSLYDQDLTGPTILIMGAEGKGMRRLTREHCDYLVNLPMAGSVSSLNVSVATGVCLFEA
QRQRSVKAKAAAKKS