Protein Info for PfGW456L13_1403 in Pseudomonas fluorescens GW456-L13

Annotation: FIG00958173: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF06790: UPF0259" amino acids 64 to 212 (149 residues), 33.4 bits, see alignment E=2.1e-12

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfo:Pfl01_4927)

Predicted SEED Role

"FIG00958173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKW0 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PfGW456L13_1403 FIG00958173: hypothetical protein (Pseudomonas fluorescens GW456-L13)
MNPLDVLRDSLYFFKRNLGQIVQLCLPLVMLEALLQQVVDHSTEPDSFPGISVIVGLLVY
PLYTAALILFLDARSRGESPRNRDLLAMAASLWPRFALLTALNTVLILLGLSLYFLPGIY
LMVTLAFGEYLLVLRGLAPLAAMKESLRMTQGHFLRILLCILCVMGPLWLLKGVTLAAYP
EPQNPVVSMLIDSAHSFLQLFTSVVLFRLFMLINPLPERNDNSL