Protein Info for PfGW456L13_1379 in Pseudomonas fluorescens GW456-L13

Annotation: Phosphate starvation-inducible protein PhoH, predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF02562: PhoH" amino acids 112 to 316 (205 residues), 323.4 bits, see alignment E=7.7e-101 PF13604: AAA_30" amino acids 119 to 269 (151 residues), 27.3 bits, see alignment E=4.4e-10 PF13245: AAA_19" amino acids 123 to 269 (147 residues), 29.9 bits, see alignment E=8.6e-11

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 96% identity to pfo:Pfl01_4951)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM26 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PfGW456L13_1379 Phosphate starvation-inducible protein PhoH, predicted ATPase (Pseudomonas fluorescens GW456-L13)
LNAPIEPHRFILEPFEARRFANLCGQFDEHLRLIEQRLTIEIRNRGNQFELIGEPKHTTS
AENLLRRLYRETKGTELSPDMVHLFLQESAVEQLDNHSPAEPSVALRTKKGMIRPRGLNQ
LRYVKEILGNDINFGIGPAGTGKTYLAVACAVDALEREQIRRILLVRPAVEAGEKLGFLP
GDLSQKIDPYLRPLYDALYEMLGFEYVAKLIERQVIEVAPLAYMRGRTLNNSFIILDESQ
NTTVEQMKMFLTRIGFGSTAVITGDITQVDLPRGTKSGLHHVIEVLKDVPGISFTHFQPK
DVVRHPLVQRIVEAYERFETKAADDAAAKDSRRDA