Protein Info for PfGW456L13_1293 in Pseudomonas fluorescens GW456-L13

Annotation: Inner membrane protein YbhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 219 to 247 (29 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 6 to 278 (273 residues), 51.4 bits, see alignment E=5.9e-18

Best Hits

Swiss-Prot: 49% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 87% identity to pfo:Pfl01_5038)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QGV1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PfGW456L13_1293 Inner membrane protein YbhQ (Pseudomonas fluorescens GW456-L13)
MLFFLMLIVLFTMLAQRIEWNEVFDTLADFKVRTLIIASGLTLVSFLVYACFDLIGRTYI
RQNLTWKQILPVGIISYAFNLNLSAWVGGIAMRYRLYSRLGVSKSNIAKILGLSLATNWF
GYMVIAGAMFSSGLVRMPPGWKLSSSALQGVGVLLLLLSAGYLVACRLAKRREWVIRGVE
IDLPSPRMAVLQLALGALNWSLMAAVIFTLLPNKLDYPLVLGVLLISAIAGVITHIPAGL
GVLEAVFVALLQHEASRGSLVAGLLAYRAIYFILPLLIALVMYLLVEAKAKSLRIAKNPK