Protein Info for PfGW456L13_1271 in Pseudomonas fluorescens GW456-L13

Annotation: SSU ribosomal protein S5p (S2e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR01021: ribosomal protein uS5" amino acids 11 to 164 (154 residues), 215 bits, see alignment E=2.4e-68 PF00333: Ribosomal_S5" amino acids 14 to 75 (62 residues), 96.7 bits, see alignment E=6.6e-32 PF03719: Ribosomal_S5_C" amino acids 90 to 158 (69 residues), 108.8 bits, see alignment E=7.4e-36

Best Hits

Swiss-Prot: 99% identical to RS5_PSEF5: 30S ribosomal protein S5 (rpsE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 94% identity to psa:PST_0801)

MetaCyc: 78% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A075PEC3 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PfGW456L13_1271 SSU ribosomal protein S5p (S2e) (Pseudomonas fluorescens GW456-L13)
MSNNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAA
IQKAMEAARRNMIQVDLNGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAG
VQNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKSVKEIF