Protein Info for PfGW456L13_1235 in Pseudomonas fluorescens GW456-L13

Annotation: Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF03702: AnmK" amino acids 3 to 363 (361 residues), 531 bits, see alignment E=8.2e-164

Best Hits

Swiss-Prot: 88% identical to ANMK_PSEPF: Anhydro-N-acetylmuramic acid kinase (anmK) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 89% identity to pba:PSEBR_a5105)

MetaCyc: 68% identical to anhydro-N-acetylmuramic acid kinase monomer (Pseudomonas aeruginosa PAO1)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PXQ9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PfGW456L13_1235 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-) (Pseudomonas fluorescens GW456-L13)
MALYIGVMSGTSLDGLDIALIEQTPAIRLIATHYIPMPDSLRTELLGLCASGPDEIARSA
IAQQNWVKLAAQGINTLLAQQHLIPDDIRAIGSHGQTIRHEPARGFTVQIGNPALLTELT
GITVVSDFRSRDVAAGGQGAPLVPAFHEALFEERAGNRAVLNIGGFSNLSLIEPGKPVAG
FDCGPGNVLLDAWIHQQRGDTYDRDGQWAASGKVEPDLLKALLSDPFFVTQGPKSTGREV
FNLPWLMQHLAQLPTFAAEDVQATLLELTALTIIESLQGAQKETQEVLVCGGGAHNAALM
NRLASLLPKAKVSSTSAYGVDPDWVEAMAFAWLAHCCLEGIAANRPSVTGARGLRVLGAI
YPA