Protein Info for PfGW456L13_1228 in Pseudomonas fluorescens GW456-L13

Annotation: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF11969: DcpS_C" amino acids 3 to 105 (103 residues), 84.5 bits, see alignment E=7.5e-28 PF01230: HIT" amino acids 10 to 106 (97 residues), 103.9 bits, see alignment E=6.2e-34

Best Hits

Swiss-Prot: 59% identical to HINT1_BOVIN: Histidine triad nucleotide-binding protein 1 (HINT1) from Bos taurus

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 95% identity to pfo:Pfl01_5107)

MetaCyc: 49% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLS0 at UniProt or InterPro

Protein Sequence (112 amino acids)

>PfGW456L13_1228 Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17) (Pseudomonas fluorescens GW456-L13)
VDTLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVVPKKPVRTLNDLTEDDKTLA
GHILFTAQRLAKELGCEDGFRVVMNCNELGGQTVYHIHMHVLGQRQMHWPPG