Protein Info for PfGW456L13_1209 in Pseudomonas fluorescens GW456-L13

Annotation: DNA-binding response regulator, LuxR family, near polyamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 20 to 132 (113 residues), 94 bits, see alignment E=6.7e-31 PF00196: GerE" amino acids 164 to 219 (56 residues), 65.3 bits, see alignment E=3.1e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfl:PFL_5640)

Predicted SEED Role

"DNA-binding response regulator, LuxR family, near polyamine transporter" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QSF2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PfGW456L13_1209 DNA-binding response regulator, LuxR family, near polyamine transporter (Pseudomonas fluorescens GW456-L13)
MWERACSRMILNLEKNVIRVLVAEDHTIVREGIKQLIGLAKDLLVVGEASNGEQLLDTLR
NVPCEVVLLDISMPGVNGLEAIPRIRALNNPPAILVLSMHDEAQMAARALKVGAAGYATK
DSDPALLLTAIRKVASGGRYIDPELADRMVFEVGLTDSRPLHSLLSEREFSVFERLAQGA
NVNDIAQQLALSSKTISTHKARLMQKLNITSLAELVKYAMEHKLL