Protein Info for PfGW456L13_1187 in Pseudomonas fluorescens GW456-L13

Annotation: DNA primase (EC 2.7.7.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 TIGR01391: DNA primase" amino acids 5 to 420 (416 residues), 484.8 bits, see alignment E=1.1e-149 PF01807: zf-CHC2" amino acids 6 to 100 (95 residues), 138.9 bits, see alignment E=1.6e-44 PF08275: DNAG_N" amino acids 126 to 254 (129 residues), 153.1 bits, see alignment E=1.7e-48 PF13662: Toprim_4" amino acids 261 to 327 (67 residues), 63.3 bits, see alignment E=8e-21 PF01751: Toprim" amino acids 262 to 339 (78 residues), 53.8 bits, see alignment E=7.2e-18 PF13362: Toprim_3" amino acids 263 to 358 (96 residues), 32 bits, see alignment E=6e-11 PF13155: Toprim_2" amino acids 264 to 351 (88 residues), 64.9 bits, see alignment E=2.9e-21 PF10410: DnaB_bind" amino acids 373 to 425 (53 residues), 44.4 bits, see alignment 6.5e-15 PF08278: DnaG_DnaB_bind" amino acids 520 to 640 (121 residues), 96.1 bits, see alignment E=8.7e-31

Best Hits

Swiss-Prot: 82% identical to DNAG_PSEPU: DNA primase (dnaG) from Pseudomonas putida

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 94% identity to pfo:Pfl01_5148)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QGG3 at UniProt or InterPro

Protein Sequence (655 amino acids)

>PfGW456L13_1187 DNA primase (EC 2.7.7.-) (Pseudomonas fluorescens GW456-L13)
MAGLIPQSFIDDLLNRTDIVDVVSSRLQLKKAGKNHTACCPFHKEKTPSFSVSPDKQFYY
CFGCGAGGNALGFIMDHDNLDFVQAVEELAKAAGMEIPREESGRPHKPRQPTDSPLYPLL
SAAADFYRQALKSHPSRKAAVEYLKGRGLTGEIARDFGLGFAPPGWDNLFKHLSSDTLQQ
KAMIDAGLLIENAESGKRYDRFRDRVMFPIRDSRGRVIAFGGRVLGDDKPKYLNSPETPV
FHKGQELYGLYEARKTNRNLDEIIVVEGYMDVIALAQQGLRNAVATLGTATSEEHLKRLF
RVVPSVLFCFDGDQAGRNAAWRALEATLSSLQDGRRARFLFLPEGEDPDTLVRSEGTDAF
RARINQHAQPLADYFFQQLTEEADPRSLEGKAHMATLAAPLIDKVPGANLRTLMRQRLSE
ITGLSGEAVSQLAQSAPQEAPPAYDPGIDYDAMPDYSDYHQPQAQEMYVPQQEWTPKKPG
AGGKKWDKKPWDKNGKRGGDRDQPRAPRVPAAVEPPTLAALRTLLHHPQLAEKVEDAGHF
AAEDHTNTQLLVALLEAVQKNPKLNSIQLIARWHGTEQGRLLKALAEKEWLIDGDNLEQQ
FFDTITSLSARQRERNLEQLLRKARQSELTSEEKNQLRDLLSRNVSASNPTSTGA