Protein Info for PfGW456L13_1065 in Pseudomonas fluorescens GW456-L13

Annotation: D-erythrose-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00044: Gp_dh_N" amino acids 44 to 145 (102 residues), 116.9 bits, see alignment E=4.5e-38 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 44 to 372 (329 residues), 581.1 bits, see alignment E=3.3e-179 PF02800: Gp_dh_C" amino acids 203 to 359 (157 residues), 165.6 bits, see alignment E=7e-53

Best Hits

Swiss-Prot: 53% identical to E4PD_PECCP: D-erythrose-4-phosphate dehydrogenase (epd) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 97% identity to pfo:Pfl01_5266)

MetaCyc: 54% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QXG5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>PfGW456L13_1065 D-erythrose-4-phosphate dehydrogenase (Pseudomonas fluorescens GW456-L13)
MPECPRCLGHHREQARSYKGCDAHKNFVWLRIIENPMPQPRPYKVALNGYGRIGRCVLRA
LFERGEKAGFEIVAINDLADMASIEYLTRFDSTHGRFPGEVKVEGDCLHINGDCVKVLRS
ATPEGIDWASLGVDLVLECSGAYHTREDGQRFLDAGAPRVLFSQPMASETDVDATIVYGV
NQDCLTGDELLVSNASCTTNCGVPLLRLLNQAIGLDYVSITTIHSAMNDQPVIDAYHHED
LRRTRSAFQSVIPVSTGLARGIERLLPELAGRIQAKAVRVPTVNVSCLDITMQTATATDA
TEVNRILREAATSGPLKGLLAYTELPHASCDFNHDPHSAIVDASQTRVSGPRLVNILAWF
DNEWGFANRMLDVAEHYLQTATSKKP