Protein Info for PfGW456L13_1055 in Pseudomonas fluorescens GW456-L13

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 259 to 275 (17 residues), see Phobius details PF00892: EamA" amino acids 145 to 275 (131 residues), 40.4 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_5275)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKR1 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PfGW456L13_1055 Integral membrane protein (Pseudomonas fluorescens GW456-L13)
VLATALVLVAALLHAAWNTLIKFSAERLLVVACMDSVALLFVVLMLPFLSVPPLEIWPWI
LASAAFELLYRYLLIQAYRVGDLGLVYPLMRGLSPLVVLALTLIFAGEVLTHQQIFGILL
IPFGMLCLLWQGGGGARLPWSMLPVVALIGLCIGCYTYIDGQALRRWSHPLDYLVWVTLL
SAWPFPLLALVRKRPAFMLFWREQWRLGLAVGFCVLFSYALVLWAMQLGSIAEAAALREI
SVILVVLFGMRYLKEPFGGPRLLACGLVLIGILVMKF