Protein Info for PfGW456L13_1041 in Pseudomonas fluorescens GW456-L13
Annotation: Putative translation initiation inhibitor, yjgF family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to Y3206_SACS2: RutC family protein SSO3206 (SSO3206) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
KEGG orthology group: None (inferred from 78% identity to pfl:PFL_5807)Predicted SEED Role
"Putative translation initiation inhibitor, yjgF family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QJ05 at UniProt or InterPro
Protein Sequence (116 amino acids)
>PfGW456L13_1041 Putative translation initiation inhibitor, yjgF family (Pseudomonas fluorescens GW456-L13) MTITRLHSNPRLSGAVTFGDLVFLSGQVPGDALDATGQTREVLAKIDTLLAEAGSDKDHL LSATIYLKNITEDFAAMNEVWSAWLSPGQAPSRTTVQAELARPQVLVEITVIAARV