Protein Info for PfGW456L13_1025 in Pseudomonas fluorescens GW456-L13

Annotation: type IV pilus biogenesis protein PilJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details PF13675: PilJ" amino acids 39 to 148 (110 residues), 95.3 bits, see alignment E=2.5e-31 PF00015: MCPsignal" amino acids 458 to 642 (185 residues), 149.6 bits, see alignment E=8.5e-48

Best Hits

Swiss-Prot: 79% identical to PILJ_PSEAE: Protein PilJ (pilJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 95% identity to pfo:Pfl01_5305)

Predicted SEED Role

"type IV pilus biogenesis protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKN6 at UniProt or InterPro

Protein Sequence (686 amino acids)

>PfGW456L13_1025 type IV pilus biogenesis protein PilJ (Pseudomonas fluorescens GW456-L13)
MIKAKAGKPMEGSRSRSQIIVLFIALIVFIMLLFANFAYLNTQAIYDKQYIGHAGELRVL
SQRIAKNATEAAAGKAAAFKLLSDARNDFARRWGFLKKGDPATGLPPAPATVRPEMRAVQ
QDWERLLKNTDAILSSEQTVLSLHQVAATLAETVPQLQVEYEKVVETLLQRGAPAAQVAM
AQRQSLLAERILGAVNTVLAGDENSQQAADAFGRDATQFGKVLNGMLQGDPALKVSQVED
RDARARLAEISELFEFVSGSVDEILETSPELFKVRESASNIFSLSQTLLDEASHLASGFE
NMVGGRTTDTIGGYVLGLLALASIILIGLVMVRETNRQLRETAEKNERNQNAIMRLLDEI
EDLADGDLTVTASVTEDFTGTIADSINYSVDQLRDLVATINLTAGQVAAAVQETQATAMH
LAQASEHQAQQISEASMAINDMAESIDQVSANAAESSAVAERSVEIANKGNEVVHNTIHG
MDNIREQIQDTAKRIKRLGESSQEIGDIVSLIDDIADQTNILALNAAIQASMAGDAGRGF
AVVADEVQRLAERSSAATRQIETLVRAIQTDTNEAVISMEQTTTEVVRGARLAQDAGVAL
EEIEGVSKTLAALIQSISNAAQQQTSSAGQISLTMNVIQQITSQTSSGSTATADSIGNLA
KMASQLRRSVSGFTLPDAKAQVVDKA