Protein Info for PfGW456L13_1018 in Pseudomonas fluorescens GW456-L13

Annotation: Putative Holliday junction resolvase YggF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF03652: RuvX" amino acids 6 to 137 (132 residues), 147.7 bits, see alignment E=1.3e-47 TIGR00250: putative transcription antitermination factor YqgF" amino acids 7 to 137 (131 residues), 146.8 bits, see alignment E=1.8e-47

Best Hits

Swiss-Prot: 97% identical to YQGF_PSEPF: Putative pre-16S rRNA nuclease (Pfl01_5312) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 97% identity to pfo:Pfl01_5312)

MetaCyc: 53% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QL76 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PfGW456L13_1018 Putative Holliday junction resolvase YggF (Pseudomonas fluorescens GW456-L13)
MALKLILGFDYGTKQIGVAVGQVITGQARELCTLKAQNGIPDWNQVEALIKEWKPDAVVV
GLPLNMDGTPSDMCARAEKFARRLNGRFNLPFYTHDERLTTFEAKGERLARGGQKGSYRD
NPVDAIAAALLLQGWLDENTALFES