Protein Info for PfGW456L13_101 in Pseudomonas fluorescens GW456-L13

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 135 (129 residues), 69.5 bits, see alignment E=1.7e-23 amino acids 150 to 280 (131 residues), 69.2 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_0572)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIH8 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PfGW456L13_101 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens GW456-L13)
MQYAYPLLAIFIWAGNTVITKMSAGAIFPAEIGFYRWLLAGLLFTPFMLKPVLAHWSQIR
PKLGKIFVLGVLGMAVYQSLAYFAASLTSATNMGIILSLMPLMSLAMAIISLGQRLTMGA
LAGAVLSFAGVLVVVSSGSLGTLLEHGVNLGDAMMLIATLAYAVYSTLLKKWQLKLPPLV
LLYLQVLVAVVVLFPLFIASPKVGPTLQNIPLVLYACLLASMVAPLAWMQAVVRLGPSRT
TQFFNLLPLITALIAAVVLHEQLAMYHLVGGVLTLGGVIVSERWTTVLGRKVSVA